LURAP1 polyclonal antibody
  • LURAP1 polyclonal antibody

LURAP1 polyclonal antibody

Ref: AB-PAB22378
LURAP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LURAP1.
Información adicional
Size 100 uL
Gene Name LURAP1
Gene Alias C1orf190|LRAP35a|LRP35A
Gene Description leucine rich adaptor protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq GTVESQTPDLRDVEGKVGRKTPEGLLRGLRGECELGTSGALLLPGASSTGHDLGDKIMALKMELAYLRAIDVKILQQLVTLNE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LURAP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 541468
Iso type IgG

Enviar uma mensagem


LURAP1 polyclonal antibody

LURAP1 polyclonal antibody