CDCA2 polyclonal antibody
  • CDCA2 polyclonal antibody

CDCA2 polyclonal antibody

Ref: AB-PAB22376
CDCA2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CDCA2.
Información adicional
Size 100 uL
Gene Name CDCA2
Gene Alias FLJ25804|MGC129906|MGC129907|Repo-Man
Gene Description cell division cycle associated 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq IKCERKDDFLGAAEGKLQCNRLMPNSQKDCHCLGDVLIENTKESKSQSEDLGRKPMESSSVVSCRDRKDRRRSMCYSDGRSLHLEKNGNHTPSS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CDCA2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 157313
Iso type IgG

Enviar uma mensagem


CDCA2 polyclonal antibody

CDCA2 polyclonal antibody