SLC26A11 polyclonal antibody
  • SLC26A11 polyclonal antibody

SLC26A11 polyclonal antibody

Ref: AB-PAB22367
SLC26A11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC26A11.
Información adicional
Size 100 uL
Gene Name SLC26A11
Gene Alias MGC46523
Gene Description solute carrier family 26, member 11
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq SAARPETKVSEGPVLVLQPASGLSFPAMEALREEILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC26A11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 284129
Iso type IgG

Enviar uma mensagem


SLC26A11 polyclonal antibody

SLC26A11 polyclonal antibody