PGBD2 polyclonal antibody
  • PGBD2 polyclonal antibody

PGBD2 polyclonal antibody

Ref: AB-PAB22363
PGBD2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PGBD2.
Información adicional
Size 100 uL
Gene Name PGBD2
Gene Alias -
Gene Description piggyBac transposable element derived 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DYKVDESEEIIVCRWHDSSVVNICSNAVGIEPVRLTSRHSGAAKTRTQVHQPSLVKLYQEKVGGVGRMDQNIAKYKVKIRGMKWYSS
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PGBD2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 267002
Iso type IgG

Enviar uma mensagem


PGBD2 polyclonal antibody

PGBD2 polyclonal antibody