SLC22A1 polyclonal antibody
  • SLC22A1 polyclonal antibody

SLC22A1 polyclonal antibody

Ref: AB-PAB22359
SLC22A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC22A1.
Información adicional
Size 100 uL
Gene Name SLC22A1
Gene Alias HOCT1|OCT1|oct1_cds
Gene Description solute carrier family 22 (organic cation transporter), member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PRWLLSQKRNTEAIKIMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFIL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC22A1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6580
Iso type IgG

Enviar uma mensagem


SLC22A1 polyclonal antibody

SLC22A1 polyclonal antibody