CLDND1 polyclonal antibody
  • CLDND1 polyclonal antibody

CLDND1 polyclonal antibody

Ref: AB-PAB22357
CLDND1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CLDND1.
Información adicional
Size 100 uL
Gene Name CLDND1
Gene Alias C3orf4|GENX-3745|MGC111162|MGC3316|MGC9861
Gene Description claudin domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq NMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWRC
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CLDND1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56650
Iso type IgG

Enviar uma mensagem


CLDND1 polyclonal antibody

CLDND1 polyclonal antibody