PNRC1 polyclonal antibody
  • PNRC1 polyclonal antibody

PNRC1 polyclonal antibody

Ref: AB-PAB22356
PNRC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PNRC1.
Información adicional
Size 100 uL
Gene Name PNRC1
Gene Alias B4-2|PNAS-145|PROL2|PRR2|RP11-63L7.5
Gene Description proline-rich nuclear receptor coactivator 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq QLVHGIHLYEQPKINRQKSKYNLPLTKITSAKRNENNFWQDSVSSDRIQKQEKKPFKNTENIKNSHLKKSAFLTEVSQKENYAGAKFSDPPSPSVLPK
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PNRC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10957
Iso type IgG

Enviar uma mensagem


PNRC1 polyclonal antibody

PNRC1 polyclonal antibody