ATXN7L2 polyclonal antibody
  • ATXN7L2 polyclonal antibody

ATXN7L2 polyclonal antibody

Ref: AB-PAB22352
ATXN7L2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ATXN7L2.
Información adicional
Size 100 uL
Gene Name ATXN7L2
Gene Alias FLJ00381|MGC46534
Gene Description ataxin 7-like 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IHSVHQRREVQGRAKDFDVLVAELKANSRKGESPKEKSPGRKEQVLERPSQELPSSVQVVAAVAAPSSTFSVRAKQTYP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ATXN7L2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 127002
Iso type IgG

Enviar uma mensagem


ATXN7L2 polyclonal antibody

ATXN7L2 polyclonal antibody