GADD45B polyclonal antibody
  • GADD45B polyclonal antibody

GADD45B polyclonal antibody

Ref: AB-PAB22350
GADD45B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GADD45B.
Información adicional
Size 100 uL
Gene Name GADD45B
Gene Alias DKFZp566B133|GADD45BETA|MYD118
Gene Description growth arrest and DNA-damage-inducible, beta
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPY
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GADD45B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4616
Iso type IgG

Enviar uma mensagem


GADD45B polyclonal antibody

GADD45B polyclonal antibody