BCL2L15 polyclonal antibody
  • BCL2L15 polyclonal antibody

BCL2L15 polyclonal antibody

Ref: AB-PAB22334
BCL2L15 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BCL2L15.
Información adicional
Size 100 uL
Gene Name BCL2L15
Gene Alias Bfk|C1orf178|FLJ22588
Gene Description BCL2-like 15
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CIVNTLLMDFLSPTLQVASRNLCCVDEVDSGEPCSFDVAIIAGRLRMLGDQFNGELEASAKNVIAETIKG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BCL2L15.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 440603
Iso type IgG

Enviar uma mensagem


BCL2L15 polyclonal antibody

BCL2L15 polyclonal antibody