MDN1 polyclonal antibody
  • MDN1 polyclonal antibody

MDN1 polyclonal antibody

Ref: AB-PAB22325
MDN1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MDN1.
Información adicional
Size 100 uL
Gene Name MDN1
Gene Alias DKFZp686H16106|FLJ23395|FLJ25587|FLJ42031|FLJ43191|KIAA0301
Gene Description MDN1, midasin homolog (yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QINEEISHLISFCLYHTPVTPQELRDLWSLLHHQKVSPEEITSLWSELFNSMFMSFWSSTVTTNPEYWLMWNPLPGMQQREAPKSVLDSTLKG
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MDN1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23195
Iso type IgG

Enviar uma mensagem


MDN1 polyclonal antibody

MDN1 polyclonal antibody