C8orf84 polyclonal antibody
  • C8orf84 polyclonal antibody

C8orf84 polyclonal antibody

Ref: AB-PAB22310
C8orf84 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C8orf84.
Información adicional
Size 100 uL
Gene Name C8orf84
Gene Alias FLJ40021|RPESP
Gene Description chromosome 8 open reading frame 84
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GWRLDRVYGTCFCDQACRFTGDCCFDYDRACPARPCFVGEWSPWSGCADQCKPTTRVRRRSVQQEPQNGG
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C8orf84.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 157869
Iso type IgG

Enviar uma mensagem


C8orf84 polyclonal antibody

C8orf84 polyclonal antibody