HGSNAT polyclonal antibody
  • HGSNAT polyclonal antibody

HGSNAT polyclonal antibody

Ref: AB-PAB22309
HGSNAT polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HGSNAT.
Información adicional
Size 100 uL
Gene Name HGSNAT
Gene Alias DKFZp686G24175|FLJ22242|FLJ32731|HGNAT|MPS3C|TMEM76
Gene Description heparan-alpha-glucosaminide N-acetyltransferase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq QALLLIHNELLWTNLTVYWKSECCYHCLFQVLVNVPQSPKAGKPSAAAASVSTQHGSILQLNDTLEEKEVCRLEYRFGEFGNYSLLVKNIHNGVSEIACDLAVN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HGSNAT.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 138050
Iso type IgG

Enviar uma mensagem


HGSNAT polyclonal antibody

HGSNAT polyclonal antibody