C9 polyclonal antibody
  • C9 polyclonal antibody

C9 polyclonal antibody

Ref: AB-PAB22308
C9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C9.
Información adicional
Size 100 uL
Gene Name C9
Gene Alias -
Gene Description complement component 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq CLGYHLDVSLAFSEISVGAEFNKDDCVKRGEGRAVNITSENLIDDVVSLIRGGTRKYAFELKEKLLRGTVIDVTDFVNWASSINDAPVLISQKLSPIYNLVPVKMKNAHLKKQNLERAIEDYINEFSVRKCHTCQNGGTVILMDGK
Form Liquid
Recomended Dilution Immunohistochemistry (1:2500-1:5000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 735
Iso type IgG

Enviar uma mensagem


C9 polyclonal antibody

C9 polyclonal antibody