EXOC3L1 polyclonal antibody
  • EXOC3L1 polyclonal antibody

EXOC3L1 polyclonal antibody

Ref: AB-PAB22307
EXOC3L1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EXOC3L1.
Información adicional
Size 100 uL
Gene Name EXOC3L1
Gene Alias FLJ35539|FLJ35587|MGC88052
Gene Description exocyst complex component 3-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MGSLELGPEADVSQLEPLLTLENIEQLEATFVANIQASVSQWLQNALDGEVAEWGREHGPNTDPSGSYYSPMPAIVLQILEENIRVASLVSESLQQRVHGMALSELGTFLRSFSDALIRFSRDHFRGKSMAPHYVPYL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EXOC3L1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 283849
Iso type IgG

Enviar uma mensagem


EXOC3L1 polyclonal antibody

EXOC3L1 polyclonal antibody