FAM116B polyclonal antibody
  • FAM116B polyclonal antibody

FAM116B polyclonal antibody

Ref: AB-PAB22306
FAM116B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM116B.
Información adicional
Size 100 uL
Gene Name FAM116B
Gene Alias MGC33692
Gene Description family with sequence similarity 116, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HFDGWYRQRHKEMALKLEALHLEAICEANIETWMKDKSEVEVVDLVLKLREKLVRAQGHQLPVKEATLQRAQLYIETVIGSLPKDLQAVLCPP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM116B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 414918
Iso type IgG

Enviar uma mensagem


FAM116B polyclonal antibody

FAM116B polyclonal antibody