ZNF655 polyclonal antibody
  • ZNF655 polyclonal antibody

ZNF655 polyclonal antibody

Ref: AB-PAB22301
ZNF655 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF655.
Información adicional
Size 100 uL
Gene Name ZNF655
Gene Alias DKFZp686M1631|FLJ23461|MGC10859|MGC16203|MGC5521|VIK|VIK-1
Gene Description zinc finger protein 655
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TDDNDKYDMSFNQNSASGKHEHLNLTEDFQSSECKESLMDLSHLNKWESIPNTEKSYKCDVCGKIFHQSSALTRHQRI
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF655.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79027
Iso type IgG

Enviar uma mensagem


ZNF655 polyclonal antibody

ZNF655 polyclonal antibody