C7orf41 polyclonal antibody
  • C7orf41 polyclonal antibody

C7orf41 polyclonal antibody

Ref: AB-PAB22299
C7orf41 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C7orf41.
Información adicional
Size 100 uL
Gene Name C7orf41
Gene Alias Ells1|FLJ25903
Gene Description chromosome 7 open reading frame 41
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MDFQQLADVAEKWCSNTPFELIATEETERRMDFYADPGVSFYVLCPDNGCGDN
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C7orf41.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 222166
Iso type IgG

Enviar uma mensagem


C7orf41 polyclonal antibody

C7orf41 polyclonal antibody