TMC7 polyclonal antibody
  • TMC7 polyclonal antibody

TMC7 polyclonal antibody

Ref: AB-PAB22295
TMC7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMC7.
Información adicional
Size 100 uL
Gene Name TMC7
Gene Alias DKFZp781O2274|FLJ21240
Gene Description transmembrane channel-like 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LDSSCFSSPPVNFLQELPSYRSIARRRTTVHSRDKQSGTLLKPTDSYSSQLEDRIAENLSSHSLRNYALNISEKRRLRDIQETQMKYLSEWDQWKRYSSKSWKRFLEKAREMTTHLE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMC7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79905
Iso type IgG

Enviar uma mensagem


TMC7 polyclonal antibody

TMC7 polyclonal antibody