KCND3 polyclonal antibody
  • KCND3 polyclonal antibody

KCND3 polyclonal antibody

Ref: AB-PAB22291
KCND3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KCND3.
Información adicional
Size 100 uL
Gene Name KCND3
Gene Alias KCND3L|KCND3S|KSHIVB|KV4.3|MGC142035|MGC142037
Gene Description potassium voltage-gated channel, Shal-related subfamily, member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NYPSTRSPSLSSHPGLTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDGLRPNCKTSQITTAIISIPTPPALTPEGESRPPPASPGPNTNIPSIASNVVKVS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KCND3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3752
Iso type IgG

Enviar uma mensagem


KCND3 polyclonal antibody

KCND3 polyclonal antibody