TDRD5 polyclonal antibody
  • TDRD5 polyclonal antibody

TDRD5 polyclonal antibody

Ref: AB-PAB22287
TDRD5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TDRD5.
Información adicional
Size 100 uL
Gene Name TDRD5
Gene Alias FLJ34823|MGC163404|RP11-427G13.1|TUDOR3
Gene Description tudor domain containing 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AMANHDIPPDAVPNKKLCRLPPLDTSSLIGVFVEYIISPSQFYIRIYSRDSSELLEDMMIEMRRCYSNQLVSDRYVMPECFIQPGHLCCVRISEDKWWYRVIIHRVLEKQEVEVFYPDFGNIGIVQKSSLRFLKCCYTK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TDRD5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 163589
Iso type IgG

Enviar uma mensagem


TDRD5 polyclonal antibody

TDRD5 polyclonal antibody