MEP1A polyclonal antibody
  • MEP1A polyclonal antibody

MEP1A polyclonal antibody

Ref: AB-PAB22286
MEP1A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MEP1A.
Información adicional
Size 100 uL
Gene Name MEP1A
Gene Alias PPHA
Gene Description meprin A, alpha (PABA peptide hydrolase)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MSSSMVFTTSKSHTSPAINDTVIWDRPSRVGTYHTDCNCFRSIDLGWSGFISHQMLKRRSFLKNDDLIIFVDFEDITHLSQTEVPTKGKRLSPQGLILQGQEQQVSEEGSGKAMLEEALPVSLSQGQPSRQKRSVE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MEP1A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4224
Iso type IgG

Enviar uma mensagem


MEP1A polyclonal antibody

MEP1A polyclonal antibody