AGPAT9 polyclonal antibody
  • AGPAT9 polyclonal antibody

AGPAT9 polyclonal antibody

Ref: AB-PAB22285
AGPAT9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AGPAT9.
Información adicional
Size 100 uL
Gene Name AGPAT9
Gene Alias AGPAT8|GPAT3|HMFN0839|LPAAT-theta|MAG1|MGC11324
Gene Description 1-acylglycerol-3-phosphate O-acyltransferase 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq ILVKTLEWATIRIEKGTPKESILKNSASVGIIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEELVSWNLLTRTN
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AGPAT9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84803
Iso type IgG

Enviar uma mensagem


AGPAT9 polyclonal antibody

AGPAT9 polyclonal antibody