PIGX polyclonal antibody
  • PIGX polyclonal antibody

PIGX polyclonal antibody

Ref: AB-PAB22284
PIGX polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PIGX.
Información adicional
Size 100 uL
Gene Name PIGX
Gene Alias FLJ20522
Gene Description phosphatidylinositol glycan anchor biosynthesis, class X
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MCSEIILRQEVLKDGFHRDLLIKVKFGESIEDLHTCRLLIKQDIPAGLYVDPYELASLRERNITEAVMVSENFDIEAPNYLSKESEVLIYARRDSQCIDCFQAFLPVHCRYHRPHSEDGEASIVVNNPDLLMFCD
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PIGX.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54965
Iso type IgG

Enviar uma mensagem


PIGX polyclonal antibody

PIGX polyclonal antibody