FAM180B polyclonal antibody
  • FAM180B polyclonal antibody

FAM180B polyclonal antibody

Ref: AB-PAB22283
FAM180B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM180B.
Información adicional
Size 100 uL
Gene Name FAM180B
Gene Alias -
Gene Description family with sequence similarity 180, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PEVMFELLWAGLELDVMGQLHIQDEELASTHPGRRLRLLLQHHVPSDLEGTEQWLQQLQDLRKGPPLSTWDFEHLLLTGLSCVYRLHAASEAEERGRWTQVFALLAQETLWDLCKGFCP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM180B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 399888
Iso type IgG

Enviar uma mensagem


FAM180B polyclonal antibody

FAM180B polyclonal antibody