KIAA2018 polyclonal antibody
  • KIAA2018 polyclonal antibody

KIAA2018 polyclonal antibody

Ref: AB-PAB22263
KIAA2018 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA2018.
Información adicional
Size 100 uL
Gene Name KIAA2018
Gene Alias DKFZp781O0144
Gene Description KIAA2018
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LKANDICLYDDPTIHWKGNLKNSKVSVVIPSDQVQKKIIVYSNGNQPGGNSQGTAVQGITFNVSHNLQKQTANVVPVQRTCNLVTPV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA2018.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 205717
Iso type IgG

Enviar uma mensagem


KIAA2018 polyclonal antibody

KIAA2018 polyclonal antibody