CST9 polyclonal antibody
  • CST9 polyclonal antibody

CST9 polyclonal antibody

Ref: AB-PAB22255
CST9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CST9.
Información adicional
Size 100 uL
Gene Name CST9
Gene Alias CLM
Gene Description cystatin 9 (testatin)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GGNNKIVQDPMFFATVEFALNTFNVQSKEEHAYRLLRVLSSWREDSMDRKWRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGV
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CST9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 128822
Iso type IgG

Enviar uma mensagem


CST9 polyclonal antibody

CST9 polyclonal antibody