FGD2 polyclonal antibody
  • FGD2 polyclonal antibody

FGD2 polyclonal antibody

Ref: AB-PAB22254
FGD2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FGD2.
Información adicional
Size 100 uL
Gene Name FGD2
Gene Alias FLJ00048|FLJ40929|MGC71330|ZFYVE4
Gene Description FYVE, RhoGEF and PH domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VTVFENSRTPEAAPRGQRLEDVHHRPECRPPESPGPREKTNVGEAVGSEPRTVSRRYLNSLKNKLSSEAWRKSCQPVTLSGSGTQEPEKKIVQEL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FGD2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 221472
Iso type IgG

Enviar uma mensagem


FGD2 polyclonal antibody

FGD2 polyclonal antibody