CEP85L polyclonal antibody
  • CEP85L polyclonal antibody

CEP85L polyclonal antibody

Ref: AB-PAB22253
CEP85L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CEP85L.
Información adicional
Size 100 uL
Gene Name CEP85L
Gene Alias RP11-57K17.2|C6orf204|NY-BR-15|bA57K17.2
Gene Description centrosomal protein 85kDa-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LDCKYKFESCSKEDFRASSSTLRRQPVDMTYSALPESKPIMTSSEAFEPPKYLMLGQQAVGGVPIQPSVRTQMW
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CEP85L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 387119
Iso type IgG

Enviar uma mensagem


CEP85L polyclonal antibody

CEP85L polyclonal antibody