TIMM17B polyclonal antibody
  • TIMM17B polyclonal antibody

TIMM17B polyclonal antibody

Ref: AB-PAB22248
TIMM17B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TIMM17B.
Información adicional
Size 100 uL
Gene Name TIMM17B
Gene Alias DXS9822|JM3|TIM17B
Gene Description translocase of inner mitochondrial membrane 17 homolog B (yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq ILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TIMM17B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10245
Iso type IgG

Enviar uma mensagem


TIMM17B polyclonal antibody

TIMM17B polyclonal antibody