BPTF polyclonal antibody
  • BPTF polyclonal antibody

BPTF polyclonal antibody

Ref: AB-PAB22246
BPTF polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BPTF.
Información adicional
Size 100 uL
Gene Name BPTF
Gene Alias FAC1|FALZ|NURF301
Gene Description bromodomain PHD finger transcription factor
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq SKLSQLKSQQVAAAAHEANKLFKEGKEVLVVNSQGEISRLSTKKEVIMKGNINNYFKLGQEGKYRVYHNQYSTNSFALNKHQHREDHDKRRHLAHKFCLTPAGEFKWNGSVHGSKVLTISTLRLTITQL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BPTF.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2186
Iso type IgG

Enviar uma mensagem


BPTF polyclonal antibody

BPTF polyclonal antibody