LRRC16A polyclonal antibody
  • LRRC16A polyclonal antibody

LRRC16A polyclonal antibody

Ref: AB-PAB22241
LRRC16A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRRC16A.
Información adicional
Size 100 uL
Gene Name LRRC16A
Gene Alias CARMIL|CARMIL1a|FLJ20048|FLJ43708|LRRC16|dJ501N12.1|dJ501N12.5
Gene Description leucine rich repeat containing 16A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq HKLADHFSRRGKTLPQQESLEIELAEEKPVKRSIITVEELTEIERLEDLDTCMMTPKSKRKSIHSRMLRPVSRAFEMEFDL
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRRC16A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55604
Iso type IgG

Enviar uma mensagem


LRRC16A polyclonal antibody

LRRC16A polyclonal antibody