CSMD3 polyclonal antibody
  • CSMD3 polyclonal antibody

CSMD3 polyclonal antibody

Ref: AB-PAB22237
CSMD3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CSMD3.
Información adicional
Size 100 uL
Gene Name CSMD3
Gene Alias KIAA1894
Gene Description CUB and Sushi multiple domains 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IPANGLRYGDDYVVGQNVSYMCQPGYTMELNGSRIRTCTINGTWSGVMPTCRAVTCPTPPQISNGRLEGTNFDWGFSISYICSPGYELSFPAVLTCVGN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CSMD3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 114788
Iso type IgG

Enviar uma mensagem


CSMD3 polyclonal antibody

CSMD3 polyclonal antibody