PHACTR4 polyclonal antibody
  • PHACTR4 polyclonal antibody

PHACTR4 polyclonal antibody

Ref: AB-PAB22233
PHACTR4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PHACTR4.
Información adicional
Size 100 uL
Gene Name PHACTR4
Gene Alias DKFZp686L07205|FLJ13171|MGC20618|MGC34186
Gene Description phosphatase and actin regulator 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GRTRSLPITIEMLKVPDDEEEEEQTCPSTFSEEMTPTSVIPKLPQCLREEEEKESDSDSEGPIQYRDEEDEDESYQSALANKVKRKDTLAMKLNHRPSE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PHACTR4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 65979
Iso type IgG

Enviar uma mensagem


PHACTR4 polyclonal antibody

PHACTR4 polyclonal antibody