TAF4B polyclonal antibody
  • TAF4B polyclonal antibody

TAF4B polyclonal antibody

Ref: AB-PAB22229
TAF4B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TAF4B.
Información adicional
Size 100 uL
Gene Name TAF4B
Gene Alias TAF2C2|TAFII105
Gene Description TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PHLVPFLKKSVVALRQLLPNSQSFIQQCVQQTSSDMVIATCTTTVTTSPVVTTTVSSSQSEKSIIVSGATAPRTVSVQTLNPLAGPVGAKAGVVTLHSVGPTAATGGTTAGTGLLQTSKPLVTSVANTVTTVSLQPEKPVVSGTAVT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TAF4B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6875
Iso type IgG

Enviar uma mensagem


TAF4B polyclonal antibody

TAF4B polyclonal antibody