SBDS polyclonal antibody
  • SBDS polyclonal antibody

SBDS polyclonal antibody

Ref: AB-PAB22225
SBDS polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SBDS.
Información adicional
Size 100 uL
Gene Name SBDS
Gene Alias CGI-97|FLJ10917|SDS|SWDS
Gene Description Shwachman-Bodian-Diamond syndrome
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SBDS.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51119
Iso type IgG

Enviar uma mensagem


SBDS polyclonal antibody

SBDS polyclonal antibody