SLC12A3 polyclonal antibody
  • SLC12A3 polyclonal antibody

SLC12A3 polyclonal antibody

Ref: AB-PAB22213
SLC12A3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC12A3.
Información adicional
Size 100 uL
Gene Name SLC12A3
Gene Alias FLJ96318|NCCT|TSC
Gene Description solute carrier family 12 (sodium/chloride transporters), member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LLIPYLLGRKRRWSKCKIRVFVGGQINRMDQERKAIISLLSKFRLGFHEVHILPDINQNPRAEHTKRFEDMIAPFRLNDGFKDEATVNEMRRDCPWKISDEEITKNRVKSLRQVRLNEIVLDYSRDAALIVITLPIGRKGKCPSS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC12A3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6559
Iso type IgG

Enviar uma mensagem


SLC12A3 polyclonal antibody

SLC12A3 polyclonal antibody