LRP5L polyclonal antibody
  • LRP5L polyclonal antibody

LRP5L polyclonal antibody

Ref: AB-PAB22211
LRP5L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRP5L.
Información adicional
Size 100 uL
Gene Name LRP5L
Gene Alias DKFZp434O0213
Gene Description low density lipoprotein receptor-related protein 5-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq VIIDQLPDLMGLKAVNVDKVVGTNPHADRNGGAATCASSRPTQPGLAAPSRAWN
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRP5L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 91355
Iso type IgG

Enviar uma mensagem


LRP5L polyclonal antibody

LRP5L polyclonal antibody