PIP3-E polyclonal antibody
  • PIP3-E polyclonal antibody

PIP3-E polyclonal antibody

Ref: AB-PAB22210
PIP3-E polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PIP3-E.
Información adicional
Size 100 uL
Gene Name PIP3-E
Gene Alias IPCEF1|KIAA0403|RP3-402L9.2
Gene Description phosphoinositide-binding protein PIP3-E
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LNSLSSDDTSSLSSNHDHLTVPDKPAGSKIMDKEETKVSEDDEMEKLYKSLEQASLSPLGDRR
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PIP3-E.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26034
Iso type IgG

Enviar uma mensagem


PIP3-E polyclonal antibody

PIP3-E polyclonal antibody