SEC14L1 polyclonal antibody
  • SEC14L1 polyclonal antibody

SEC14L1 polyclonal antibody

Ref: AB-PAB22209
SEC14L1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SEC14L1.
Información adicional
Size 100 uL
Gene Name SEC14L1
Gene Alias DKFZp686C06176|PRELID4A|SEC14L
Gene Description SEC14-like 1 (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SVFKGAPHEILIQIVDASSVITWDFDVCKGDIVFNIYHSKRSPQPPKKDSLGAHSITSPGGNNVQLIDKVWQLGRDYSMVESPLICKEGESVQG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SEC14L1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6397
Iso type IgG

Enviar uma mensagem


SEC14L1 polyclonal antibody

SEC14L1 polyclonal antibody