MARC1 polyclonal antibody
  • MARC1 polyclonal antibody

MARC1 polyclonal antibody

Ref: AB-PAB22208
MARC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MARC1.
Información adicional
Size 100 uL
Gene Name MARC1
Gene Alias RP11-295M18.1|MOSC1
Gene Description mitochondrial amidoxime reducing component 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq NQEGNMVTARQEPRLVLISLTCDGDTLTLSAAYTKDLLLPIKTPTTNAVHKCRVHGLEIEGRDCGEATAQWITSFLKSQPYRLVHFEPHMRPRRPHQIADLFRPKDQIAYSDTSPFLILSEASLADLNSRLEKKVKATNFRPNIVISGC
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MARC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64757
Iso type IgG

Enviar uma mensagem


MARC1 polyclonal antibody

MARC1 polyclonal antibody