FLG2 polyclonal antibody
  • FLG2 polyclonal antibody

FLG2 polyclonal antibody

Ref: AB-PAB22207
FLG2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FLG2.
Información adicional
Size 100 uL
Gene Name FLG2
Gene Alias IFPS
Gene Description filaggrin family member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CGYSNSSGCGRPQNASSSCQSHRFGGQGNQFSYIQSGCQSGIKGGQGHGCVSGGQPSGCGQPESNPCSQSYSQRGYGARENGQPQNCGGQWRTGSSQSSCCG
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FLG2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 388698
Iso type IgG

Enviar uma mensagem


FLG2 polyclonal antibody

FLG2 polyclonal antibody