LPO polyclonal antibody
  • LPO polyclonal antibody

LPO polyclonal antibody

Ref: AB-PAB22206
LPO polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LPO.
Información adicional
Size 100 uL
Gene Name LPO
Gene Alias MGC129990|MGC129991|SPO
Gene Description lactoperoxidase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IVGYLNEEGVLDQNRSLLFMQWGQIVDHDLDFAPDTELGSSEYSKAQCDEYCIQGDNCFPIMFPPNDPKAGTQGKCMPFFRAGFVCPTPPYKSLAR
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LPO.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4025
Iso type IgG

Enviar uma mensagem


LPO polyclonal antibody

LPO polyclonal antibody