CHD1L polyclonal antibody
  • CHD1L polyclonal antibody

CHD1L polyclonal antibody

Ref: AB-PAB22203
CHD1L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CHD1L.
Información adicional
Size 100 uL
Gene Name CHD1L
Gene Alias ALC1|CHDL|FLJ22530
Gene Description chromodomain helicase DNA binding protein 1-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq GSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTLLEKASQEGRSLRNKGSVLIPGLVEGSTKRKRVLSPEELEDRQKKRQEAAAKRRRLIEEKKR
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CHD1L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9557
Iso type IgG

Enviar uma mensagem


CHD1L polyclonal antibody

CHD1L polyclonal antibody