CHTOP polyclonal antibody
  • CHTOP polyclonal antibody

CHTOP polyclonal antibody

Ref: AB-PAB22197
CHTOP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CHTOP.
Información adicional
Size 100 uL
Gene Name CHTOP
Gene Alias HT031|C1orf77|FL-SRAG|FOP|RP1-178F15.2|SRAG|SRAG-3|SRAG-5|pp7704
Gene Description chromatin target of PRMT1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq GRGRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CHTOP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26097
Iso type IgG

Enviar uma mensagem


CHTOP polyclonal antibody

CHTOP polyclonal antibody