IQCC polyclonal antibody
  • IQCC polyclonal antibody

IQCC polyclonal antibody

Ref: AB-PAB22191
IQCC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IQCC.
Información adicional
Size 100 uL
Gene Name IQCC
Gene Alias FLJ10547|MGC120341|RP4-622L5.6
Gene Description IQ motif containing C
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RTVRTQELGLSEDHIIWDGTLGGPEHSVLDLWRTKPPKGQAPTDRSSRDGTSNEPSHEGQKKQRTIPWRSKSPEILSSTKAGCTGEEQWRGRPWKTEPPG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IQCC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55721
Iso type IgG

Enviar uma mensagem


IQCC polyclonal antibody

IQCC polyclonal antibody