SPAG17 polyclonal antibody
  • SPAG17 polyclonal antibody

SPAG17 polyclonal antibody

Ref: AB-PAB22189
SPAG17 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPAG17.
Información adicional
Size 100 uL
Gene Name SPAG17
Gene Alias DKFZp434B0610|FLJ34497|FLJ44343|FLJ44353|PF6|RP4-776P7.2
Gene Description sperm associated antigen 17
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SVPLILHCMLEQVVATEEDLVPPSLREPSPRADGLDHRIAAHIVSLLPSLCLSEREKKNLHDIFLSEEENESKAV
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPAG17.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 200162
Iso type IgG

Enviar uma mensagem


SPAG17 polyclonal antibody

SPAG17 polyclonal antibody