FAM211A polyclonal antibody
  • FAM211A polyclonal antibody

FAM211A polyclonal antibody

Ref: AB-PAB22173
FAM211A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM211A.
Información adicional
Size 100 uL
Gene Name FAM211A
Gene Alias C17orf76
Gene Description family with sequence similarity 211, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GMVQELLRMVRQGRREEAGTLLQHLRQDLGMESTSLDDVLYRYASFRNLVDPITHDLIISLARYIHCPKP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM211A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 388341
Iso type IgG

Enviar uma mensagem


FAM211A polyclonal antibody

FAM211A polyclonal antibody