ZNF326 polyclonal antibody
  • ZNF326 polyclonal antibody

ZNF326 polyclonal antibody

Ref: AB-PAB22160
ZNF326 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF326.
Información adicional
Size 100 uL
Gene Name ZNF326
Gene Alias FLJ20403|MGC61591|ZAN75|Zfp326|dJ871E2.1
Gene Description zinc finger protein 326
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HMMKVETVHCSACSVYIPALHSSVQQHLKSPDHIKGKQAYKEQIKRESVLTATSILNNPIVKARYERFVKGENPFEIQDHSQDQQI
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF326.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 284695
Iso type IgG

Enviar uma mensagem


ZNF326 polyclonal antibody

ZNF326 polyclonal antibody