C1orf59 polyclonal antibody
  • C1orf59 polyclonal antibody

C1orf59 polyclonal antibody

Ref: AB-PAB22159
C1orf59 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C1orf59.
Información adicional
Size 100 uL
Gene Name C1orf59
Gene Alias FLJ30525|HEN1|MGC111091|RP11-256E16.2
Gene Description chromosome 1 open reading frame 59
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MEENNLQCSSVVDGNFEEVPRETAIQFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTSLLRLLKVNPCIELLVGV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C1orf59.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 113802
Iso type IgG

Enviar uma mensagem


C1orf59 polyclonal antibody

C1orf59 polyclonal antibody